PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn127811
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 474aa    MW: 51643.4 Da    PI: 5.5327
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn127811genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.82.9e-34257311155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kpr+rWtpeLHe+Fveav++LGGsekAtPk +l+lmkv+gLt++hvkSHLQkYR+
  Achn127811 257 KPRMRWTPELHEAFVEAVNKLGGSEKATPKGVLKLMKVEGLTIYHVKSHLQKYRT 311
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.743254314IPR017930Myb domain
SuperFamilySSF466893.05E-18255311IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-31256313IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-25257311IPR006447Myb domain, plants
PfamPF002492.8E-10259310IPR001005SANT/Myb domain
PfamPF143792.2E-25342389IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MEARQALSIQ RSSAGQISNH GASGALSSSL PVLPAGLEEK SHKFPDTQPV SVERELNTNS  60
MTLHSSLPSS NGVVGPIFSS TSGFSSNLHY SSISTPGKHT RKSPFISQSS NSGESLPLTP  120
CDSRMLQSMS NNGSWCRDSL PNFFDYPANT PVRNSQLGST SNGDSSTATE DPGKRSDWQD  180
WADQLITEDD SLTSNWNEFF ADSNVEDPEL KVGFQVAKPS INVSETQPQV LGMIPLPSGE  240
SSSVPNATSS SGGAPTKPRM RWTPELHEAF VEAVNKLGGS EKATPKGVLK LMKVEGLTIY  300
HVKSHLQKYR TARYRPEPSE GSTEKKLTPI EELASLDLKT GIEITEALRL QMEVQKRLHE  360
QLEIQRSLQL RIEEQGRYLQ MMFEKQCKAG GMLKTSPSSP ENLSAETKDA VPNSPAKNES  420
GTSQLDLEEK EHVITASVPL SRELGEKQKL RESEENVVEE SSSQPSKRAK TGE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002270511.11e-180PREDICTED: protein PHR1-LIKE 1
TrEMBLF6HZP91e-180F6HZP9_VITVI; Putative uncharacterized protein
STRINGVIT_07s0005g04120.t011e-180(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27532349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.11e-105phosphate starvation response 1